A Sunday excursion and a May Day cycle trip - exploring the Late Iron Age oppidum Heidengraben and visiting our darling Nephos, who had the most amazing green lizard friend with him. #badenwürttemberg #keltenlandbw #celticarchaeology #heidengraben #heidengrabenzentrum #keltenerlebnispfad #nephos #imissyoumylittleblue #lizard
Archaeoethnologica: Da Chefia ao Estado na Irlanda - Livro +INFO in: https://archaeoethnologica.blogspot.com/2024/04/da-chefia-ao-estado-na-irlanda.html #Archaeology #Medieval #Protohistory #IronAge #Ireland #celts #politicalstructure #institutions #Chiefdom #State #books #celticarchaeology
Archaeoethnologica: Da Chefia ao Estado na Irlanda - Livro +INFO in: https://archaeoethnologica.blogspot.com/2024/04/da-chefia-ao-estado-na-irlanda.html #Archaeology #Medieval #Protohistory #IronAge #Ireland #celts #politicalstructure #institutions #Chiefdom #State #books #celticarchaeology
Archaeoethnologica: Da Chefia ao Estado na Irlanda - Livro +INFO in: https://archaeoethnologica.blogspot.com/2024/04/da-chefia-ao-estado-na-irlanda.html #Archaeology #Medieval #Protohistory #IronAge #Ireland #celts #politicalstructure #institutions #Chiefdom #State #books #celticarchaeology
Archaeoethnologica: Da Chefia ao Estado na Irlanda - Livro +INFO in: https://archaeoethnologica.blogspot.com/2024/04/da-chefia-ao-estado-na-irlanda.html #Archaeology #Medieval #Protohistory #IronAge #Ireland #celts #politicalstructure #institutions #Chiefdom #State #books #celticarchaeology
Archaeoethnologica: Da Chefia ao Estado na Irlanda - Livro +INFO in: https://archaeoethnologica.blogspot.com/2024/04/da-chefia-ao-estado-na-irlanda.html #Archaeology #Medieval #Protohistory #IronAge #Ireland #celts #politicalstructure #institutions #Chiefdom #State #books #celticarchaeology
At least I have a sense of humor while I’m taking notes. #archaeologygradstudent #uoeancientworlds #celticarchaeology #ironagearchaeology #agarchaeology #termpapernotes
Comme une envie de me replonger dans mes bouquins d'archéologie... Art celte avec le bouclier de Battersea, les oenochoés de Basse-Yutz, le miroir de Desborough et le torque de Snettisham. #celticart #celtic #archaeology #celticarchaeology #latene #ironage #protohistory #antique #britishmuseum #history #arthistory
Is this the earliest dental implant in western Europe? An individual from an Iron Age burial had an iron pin in place of a missing tooth #NationalDentistsDay 🦷 🔗 from 2014 (£) https://buff.ly/36UDNLo
When you come full circle back to the articles you pulled for your first postgrad class. #celticarchaeology #uoeancientworlds #archaeologygradstudent
15th prompt of #prehistovember is WARFARE. Walking the line between Prehistory and Antiquity with this one. This is a war trophy inspired by the one found at the oppidum of Corent, near the Gergovian plateau. The thing about this "scarecrow" trophies or tropaion is that they were used by the ancient Greeks as a way of commemorating a victory and displaying the armor and weapons of the fallen foes and the Romans later took on that tradition. Piles of armor and weapons have been found in Gaulish or Celtic sites, like this one at Corent (located in a sanctuary's enclosure), that suggest a similar way of showing their victories in war. Interestingly enough, it has been noted that Roman records start showing this kind of mannequin shaped trophies after the Gallic Wars, what makes very possible that they actually took this existing tradition from the Iron Age tribes of western Europe. #prehistovember2023 #prehistorychallenge #ironage #ironagearchaeology #gaulish #galloroman #celts #celtic #celticarchaeology #gallicwars #tropaion #trophy #archaeology #archaeologicalillustration #recentprehistory #ancientwarfare #ancientwar #ancientwarrior #celticwarrior #artchallenge
Στο 1ο βιβλίο της σειράς ''Το μυστικό της Παγωμένης Σπηλιάς'' επέλεξα να εντάξω τον κερασφόρο θεό. Η παράσταση που απεικονίζεται στο ιερό δέντρο και παριστάνει το θεό Cernunnos της κέλτικης θρησκείας, διακοσμεί μέρος της χύτρας του Γκούντεστρουπ που βρέθηκε σε ένα έλος κοντά στο Ροβεμόσεν της Δανίας. Παρά το γεγονός ότι αρκετές μορφές παριστάνουν Κέλτες πολεμιστές και κελτικές θεότητες με περιλαίμια, πολλά είναι τα στοιχεία της διακόσμησης που ακολουθούν χαρακτηριστικά της Θρακικής τέχνης, όπως η χρήση του αργύρου, που ήταν διαδεδομένη στον θρακικό κόσμο αλλά σπάνια στην τέχνη των Κελτών. Πιθανολογείται οτι το σκεύος κατασκευάστηκε κάπου στην περιοχή του μέσου Δούναβη τον 2ο ή 1ο αι. π.χ. αλλά δεν είναι γνωστός ο τρόπος που μεταφέρθηκε στο δανέζικο βάλτο. #gundestrupcauldron #celticarchaeology #celticreligion
Roadside standing stones at Balnuaran of Clava (Clava Cairns) 🪨🌿🚙 #clavacairns #passagegraves #ringcairns #balnuaranofclava #inverness #culloden #nairn #scotland #cairns #standingstones #ancientplaces #historicalplaces #history #megalithic #neolithic #bronzeage #pictish #archaeology #scottisharchaeology #celticarchaeology #celtic
Another cairn at Balnuaran of Clava (Clava Cairns) 🪨🌿 #clavacairns #passagegraves #ringcairns #balnuaranofclava #inverness #culloden #nairn #scotland #cairns #standingstones #ancientplaces #historicalplaces #history #megalithic #neolithic #bronzeage #pictish #archaeology #scottisharchaeology #celticarchaeology #celtic
Balnuaran of Clava (Clava Cairns) 🪨🌿 The Clava Cairns, is a series of passage graves, ring cairns, standing stones and medieval chapel ruins. Dating to the Bronze age (around 2000 BC) the site was an important place for ritual and burial activities with continued significance for over a millennia. Many of the monuments are also aligned to the midwinter sunset 🌅🌾 #clavacairns #passagegraves #ringcairns #balnuaranofclava #inverness #culloden #nairn #scotland #cairns #standingstones #ancientplaces #historicalplaces #history #megalithic #neolithic #bronzeage #pictish #archaeology #scottisharchaeology #celticarchaeology #celtic
Ring cairn at the Balnuaran of Clava (Clava Cairns) 🪨🌿 #ringcairn #clavacairns #balnuaranofclava #inverness #culloden #nairn #scotland #cairns #standingstones #ancientplaces #historicalplaces #history #historical #megalithic #neolithic #bronzeage #pictish #archaeology #scottisharchaeology #celticarchaeology #celtic
Standing stones and Kerb cairn at the Balnuaran of Clava (Clava Cairns) 🪨🌿 The Clava Cairns, is a series of passage graves, ring cairns, standing stones and medieval chapel ruins. Dating to the Bronze age (around 2000 BC) the site was an important place for ritual and burial activities with continued significance for over a millennia. Many of the monuments are also aligned to the midwinter sunset 🌅🌾 #clavacairns #balnuaranofclava #inverness #culloden #nairn #scotland #cairns #standingstones #ancientplaces #historicalplaces #history #historical #megalithic #neolithic #bronzeage #pictish #archaeology #scottisharchaeology #celticarchaeology #celtic
Embark on an extraordinary adventure into the ancient Celtic world with our Celtic Archaeology MA at Bangor University. Uncover the mysteries of the past, explore ancient landscapes, and decipher the rich cultural heritage of the Celts. It provides the opportunity for students to specialise in a particular academic area so as to gain a close understanding of the archaeological debates surrounding it. 👉 𝐂𝐨𝐧𝐭𝐚𝐜𝐭 𝐮𝐬:https://wa.me/8801958049420 Join our passionate community of archaeologists and historians to preserve and celebrate this fascinating legacy. Let the past come alive through your discoveries! ♻️𝐓𝐨 𝐤𝐧𝐨𝐰 𝐦𝐨𝐫𝐞, 𝐯𝐢𝐬𝐢𝐭 𝐮𝐬 𝐚𝐭- 📌𝐁𝐚𝐧𝐠𝐨𝐫 𝐔𝐧𝐢𝐯𝐞𝐫𝐬𝐢𝐭𝐲 𝐑𝐞𝐩𝐫𝐞𝐬𝐞𝐧𝐭𝐚𝐭𝐢𝐯𝐞 𝐎𝐟𝐟𝐢𝐜𝐞 - 𝐁𝐚𝐧𝐠𝐥𝐚𝐝𝐞𝐬𝐡 𝐑𝐮𝐩𝐚𝐲𝐚𝐧 𝐏𝐫𝐢𝐦𝐞 (𝟕𝐭𝐡 𝐅𝐥𝐨𝐨𝐫), 𝐇𝐨𝐮𝐬𝐞# 𝟎𝟐, 𝐑𝐨𝐚𝐝# 𝟎𝟕, 𝐆𝐫𝐞𝐞𝐧 𝐑𝐨𝐚𝐝, 𝐃𝐡𝐚𝐧𝐦𝐨𝐧𝐝𝐢- 𝟏𝟐𝟎𝟓 𝐃𝐡𝐚𝐤𝐚. ☎ +𝟖𝟖𝟎 𝟏𝟗𝟓𝟖-𝟎𝟒𝟗𝟒𝟐𝟎 📩 𝐛𝐚𝐧𝐠𝐥𝐚𝐝𝐞𝐬𝐡@𝐛𝐚𝐧𝐠𝐨𝐫.𝐚𝐜.𝐮𝐤 #bangoruniversity #studyabroad #CelticArchaeology #StudentExperienceUK #StudyinUK #HigherStudy #BangorWelsh #BangorEducation #BangorScholars
2,000 year old signant ring. Celtic or Roman. Not found with skeletal remains. Lost love of house and family symbol by owner 2k years ago. #archaeology #ancient #antique #ring #celtic #roman #art #celticarchaeology #romanempire #jewelry #ancientjewelry
Perched on a hill outside Armagh city is Emain Macha - or Navan Fort. For centuries this place was home to the kings and queens of Ulster. In recent years archaeologists have been trying to piece together just what the complex would have looked like and how far back in history the site was in use. They believe they have now found physical evidence that the site could have been in use as early as the 4th Century BC. https://www.bbc.com/news/uk-northern-ireland-66514152 (link in story & highlight) #celtic #celtichistory #irishhistory #celticarchaeology #irisharchaeology #celticnews #ulster #ireland
Der Poulnabrone Dolmen (Portal Tomb) in der Grafschaft Clare ist einer der meistfotografierten neolithischen Fundorte Irlands. Diese megalithischen Bauwerke sind überall in Irland zu finden und weisen auf eine hoch zivilisierte, organisierte Kultur hin. In den Achtziger Jahren bereits wurde Poulnabrone von der Archäologin Dr Lynch exkaviert. Die Fundgegenstände, darunter Grabbeigaben und menschliche Skelette, werden teils im Museum Ennis ausgestellt. #poulnabronedolmen #portaltomb #portaltombsofireland #archäologie #celticarchaeology #archaeology #clare #irlandmitstephanieflahertyklapp #ireland #grüneinsel #urlaubtipps #studienurlaub #westireland #newgrange #indianajones #ennis #excavation #ausgrabung #bones
The current reading stack, collected works of Miranda Green. Her archaeological approach to this work is refreshing and to be frank sorely needed. #celts #ironagebritain #druids #pagan #witch #witchesofinstagram #druidsofinstagram #pagansofinstagram #mirandagreen #celticpaganism #celticarchaeology
Kalender-Boy! ❤️ Unsere Replik durfte Seit' and Seit' mit dem Original für den Keltenland Hessen Kalender 2020 modeln und wurde Mister Februar. Calendar Boy! ❤️ One replica of a celtic archaeological find was preseted together with the original in the calendar of the project "Keltenland Hessen" 2020 in February. Fotos für den Kalender: P. Odvody, hessenARCHÄOLOGIE. #celticarchaeology #celticart #glauberg #keltenweltglauberg #keltenlandhessen #hessenarchäologie #archaeology #celts #europeanarchaeology #metaldetecting
Archaeoethnologica: La Tene in Moravia - Book / La Tene em Moravia - Livro +INFO in: https://archaeoethnologica.blogspot.com/2023/05/la-tene-em-moravia-livro.html #celticarchaeology #latene #archaeology #protohistory #ironage #ironagearchaeology #celtraleuropeanarchaeology #moravia #protohistoricalarchaeology
Archaeoethnologica: La Tene in Moravia - Book / La Tene em Moravia - Livro +INFO in: https://archaeoethnologica.blogspot.com/2023/05/la-tene-em-moravia-livro.html #celticarchaeology #latene #archaeology #protohistory #ironage #ironagearchaeology #celtraleuropeanarchaeology #moravia #protohistoricalarchaeology
Archaeoethnologica: La Tene in Moravia - Book / La Tene em Moravia - Livro +INFO in: https://archaeoethnologica.blogspot.com/2023/05/la-tene-em-moravia-livro.html #celticarchaeology #latene #archaeology #protohistory #ironage #ironagearchaeology #celtraleuropeanarchaeology #moravia #protohistoricalarchaeology
Archaeoethnologica: La Tene in Moravia - Book / La Tene em Moravia - Livro +INFO in: https://archaeoethnologica.blogspot.com/2023/05/la-tene-em-moravia-livro.html #celticarchaeology #latene #archaeology #protohistory #ironage #ironagearchaeology #celtraleuropeanarchaeology #moravia #protohistoricalarchaeology
⛏️MINAS DE SAL DE HALLSTATT. 1️⃣ Reconstrucción de lo que habrían sido las minas de sal de Hallstatt en su interior. 2️⃣,3️⃣ y 4️⃣. Restos de la escalera de madera por la que sacaban al exterior la sal extraída. Es un tramo muy bien conservado gracias al ambiente salado, siendo una de las escasas condiciones especiales en las que se conserva la materia orgánica durante miles de años, desde la Edad del Hierro I. Gracias a recientes estudios químicos, hemos descubierto restos de cerdo en salazón y de otros vegetales de los que se alimentaban los trabajadores de las minas. Por esto, sabemos que estas personas, probablemente en estado de esclavitud, hacían su vida en el interior de las minas ( Imagen 1). #arqueología #Hallstatt #EdaddelHierro #prehistoria #celtas #íberos #celtíberos #Austria #archaeology #celticarchaeology #keltenarchäologie
ENTRE DEUX EAUX. LA TÈNE, LIEU DE MÉMOIRE Dévoilant pour la première fois la quasi-totalité des trouvailles abritées dans les dépôts du Laténium ainsi qu’une abondante sélection de documents historiques, l’exposition propose une évocation onirique de l’histoire de ce lieu de mémoire. ZWISCHEN ZWEI GEWÄSSERN. ERINNERUNGSORT LA TÈNE Die Ausstellung, anlässlich der zum ersten Mal fast alle im Museumsdepot aufbewahrten Fundstücke aus La Tène, sowie eine umfassende Auswahl von historischen Dokumenten gezeigt werden, schlägt eine traumhafte Beschwörung der Geschichte dieses «Erinnerungsortes» vor. #laténium #latène #ironage #celticarchaeology #Neuchâtel #Switzerland #iloveswissmuseums
The Pictish tribes were some of the most fierce warriors in the British Isles during the Bronze Age. #celticarchaeology #militaryhistory #madrasarsenal
This week's OA highlight from our 50 years in archaeology is a truly exceptional find. In 2003, our colleagues in the Lancaster office were working on the upgrade of the A1 near Ferrybridge, West Yorkshire, when they uncovered this Iron Age chariot burial. To date, only 22 chariot burials have been found in Britain. They date to the Middle Iron Age, between 350 and 150 BC, and most of them were found in East Yorkshire, where the chariots had been dismantled ahead of burial. But the Ferrybridge one really stands out as the chariot was buried upright and intact. Together with the chariot, OA archaeologists found the remains of a 30-40 years old man that would originally have been buried in an upright position. Curiously, the two wheels didn't match, suggesting that the chariot was probably assembled especially for this individual's funerary rites and burial. #OAthroughtime #50highlights #OAat50 #ironage #ironagebritain #yorkshire #westyorkshire #archaeologistsofinstgram #archaeologyfieldwork #britisharchaeology #archaeologylovers #archaeologylife #archaeologist #fieldwork #archaeology #prehistoricarchaeology #celticbritain #celticarchaeology #britainbeforeromaninvasion #yorkshirelovers #ironagearchaeology #chariotburials #archaeologie #archeologia #ukarchaeology #localhistory #discoveringbritain
'The Druids.' Peter Berresford Ellis. Constable And Company 1994 paperback. In very good condition. $12.00 Priests indulging in human sacrifice and forecasting the future from human entrails. Some say they were amiable sorcerers. Others portray them as the intelligentsia of ancient Celtic society. In this book, Peter Berresford Ellis sifts through the evidence, and, with reference to the latest archaeological findings and the use of etymology, he provides the reader with the first authentic account of who and what they were. The Druids emerge as the intellectual caste of ancient Celtic society. They were the doctors, the lawyers, the ambassadors, the advisers to kings. They also had a religious function. Ellis describes the special Druidic training, their philosophy, their belief in auguries, and their intriguing origins. The Roman description of the Druids, he shows, was the bellicose propaganda of an empire anxious to rob them of their power in the Celtic territories. He shows that the current 'New Age' image of them as benevolent wizards comes from a woefully inadequate interpretation of the facts. #thedruids #celticarchaeology #celtichistory #celtichistoryandculture #peterberresfordellis
Vous aussi, venez découvrir la nouvelle présentation de l'espace des Celtes de La Tène ! 📷 Laténium, David Marchon. Photographies réalisées à l'occasion de l'inauguration mardi 10 janvier 2023. @davidmarchon.ch #laténium #archéologie #latène #âgedufer #ironage #celticworld #celticarchaeology #celtes #celtics #Neuchâtel #Switzerland #iloveswissmuseums
N'hésitez pas à suivre également le Laténium sur Instagram ! 👉 @museelatenium ・・・ Nous relayons ici avec plaisir sa publication «Inauguration du nouvel espace des Celtes de La Tène» Mardi soir, la Fondation La Tène a organisé un événement accueillant les donatrices et les donateurs qui ont participé au financement du renouvellement de cet espace. A la suite d'une partie officielle, en présence du conseiller d'État Alain Ribaux, le directeur du Laténium, Marc-Antoine Kaeser, a inauguré ce dernier en le présentant au public. Nous nous réjouissons de vous accueillir au Laténium pour que vous puissiez à votre tour découvrir les nouveaux dispositifs de cette salle et le résultat des recherches scientifiques récentes menées autour du site emblématique de La Tène. 📷 Laténium, David Marchon @davidmarchon.ch @instaneuch #instaneuch #laténium #archéologie #latène #âgedufer #ironage #celticworld #celticarchaeology #celtes #celtics #Neuchâtel #Switzerland #iloveswissmuseums
Inauguration du nouvel espace des Celtes de La Tène Mardi soir, la Fondation La Tène a organisé un événement accueillant les donatrices et les donateurs qui ont participé au financement du renouvellement de cet espace. A la suite d'une partie officielle, notre directeur, Marc-Antoine Kaeser, a inauguré ce dernier en le présentant au public. Nous nous réjouissons de vous accueillir au Laténium pour que vous puissiez à votre tour découvrir les nouveaux dispositifs de cette salle et les résultats des recherches scientifiques récentes menées autour du site emblématique de La Tène. 📷 Laténium, David Marchon @davidmarchon.ch @instaneuch #laténium #archéologie #latène #âgedufer #ironage #celticworld #celticarchaeology #celtes #celtics #Neuchâtel #Switzerland #iloveswissmuseums
Entre lumière naturelle et éclairage, il faut parfois plusieurs essais avant de trouver la bonne position d’un objet en vitrine. Ici, la petite monnaie en argent (obole) découverte à Marin/Les Bourguignonnes et datée du 2e s. av. n.è. est déplacée par notre conservatrice pour que le public puisse mieux l’apprécier. Le motif du droit de cette pièce (une tête de profil, ceinte d'un bandeau) est depuis peu projeté au sol de l’espace des Celtes de La Tène, juste à côté de la monnaie en question. #ironage #ironageeurope #Neuchâtel #heritage #patrimoine #archaeology #laténium #collections #iloveswissmuseums #museumlife #celticarchaeology #celticart #celticartwork #monnaie #Switzerland
Sculpture depicting divinity with lyre, from Paule-Saint-Symphorien, Brittany🗿 #lyredepaule #lyre #crwth #lira #bards #bard #celtic #celticharp #harp #celticgods #celticartwork #celticarchaeology #archeology #brittany #breton #bretagna #illustration #ink #inkillustration #illustrator #illustrazione #celt #celts #celtic #inkdrawing #inkart
🎃🍁🍂🦌𝕬𝖑𝖑 𝖍𝖆𝖎𝖑 𝖙𝖍𝖊 𝕶𝖎𝖓𝖌 🦌🍂🍁🎃 Blessed Samhain and happy Halloween everybody! Samhain is an early medieval Irish festival, and we don't know whether the continental Celts had a similar celebration. In all probability they possibly did, but we know neither the exact name of it, nor the time. The Coligny calendar (likely dating to the 2nd century CE, but possibly older) mentions a month 'Samonios' which, taking into consideration the complicated way this calendar operates with moon phases etc., would probably be the month before or around the winter solstice. Samon- has connections to Irish samrad, meaning summer (Samhain = Summer's end). There's no way of knowing though whether Samonios is corresponding to our November, December, or any other month, nor whether there was any feast going with it. A good compromise is to just go by feeling. If the time feels right, then it probably is. There are some theories that claim the Celts went by moon phases or the position of the sun, which may all be true, but even more than that I believe they went by the signs of nature: acorns falling, leaves turning brown, mushrooms appearing, the first night frosts and so on. So in short, I believe there may have been something like an entire week or stretch of days that were dedicated to 'Samonios' celebrations of some sort. (Picture was taken at the celtic oppidum Dünsberg, the oak crown for this modern sandstone relief of a horned god was made spontaneously from local finds 😄) #samhain #samonios #hornedgod #cernunnos #celtic #celts #continentalcelts #celticcelebrations #celticarchaeology #colignycalendar #wheeloftheyear #pagancelebrations #pagansofinstagram #paganism #celticpagan #oakking #oaks #oakcrown #greenman #leafcrown #celticoppidum #oppidum #dünsberg
The Battersea Shield Found in the River Thames at Battersea Bridge, London Around 350-50 BC The Battersea shield is one of the finest examples of La Tène, or Celtic art, from Britain. It was deposited in the river perhaps as an offering to the Gods. The shield is decorated with three raised circular panels. The decoration is enhanced with inlayed red glass or enamel. The thin metal and short length of the shield would not have provided adequate protection in battle. Instead the shield was probably made for flamboyant display. It is made of several bronze sheets and a binding strip, held together with bronze rivets. Originally these bronze sheets would have formed the facing for a wooden base, which no longer survives. #shield #englishhistory #england #celticart #celticarchaeology
montage des vidéos sur La Tène pour la future nouvelle salle de l'expo permanente du #museelatenium #latenium #latene #celticarchaeology
Bog bodies and contemporary research on them Bog bodies are especially preserved human remains found in peat bogs. The special biological conditions in peatlands, resulting from the long-term predominance of rainfall over water evaporation, often found in northern Europe, contribute to the exceptional preservation of the remains of organisms, including human remains, usually found by chance. Due to the acidic conditions of the soil, human skin, internal organs, as well as hair and nails are mummified. However, these acids do not always have a positive effect on bone preservation, which makes the found bodies often resemble skin bags. Individual cases of mummified human remains found in peat bogs date back widely between the Mesolithic (Koelbjerg Man ,Denmark - 8,000 BC, preserved skeleton) and the Second World War. Nowadays, researchers in the field of archeology and criminology are able to extract from specific remains many details about the life of a given person, the conditions and period in which they lived and the circumstances of their death. . Rest of the text in the comments below ⬇️ . Text and graphics by @antropoceltism
En 2017, j'ai soutenu un mémoire sur les sculptures gauloises portant un torque, ce collier tour-de-cou si fascinant. J'ai donc profité d'une petite halte à Rennes il y a quelques semaines pour aller visiter l'exposition Celtique ? au musée de Bretagne et, enfin, voir cette petite merveille découverte à Paule (22) en 1988, datée du IIe siècle avant notre ère et sur laquelle j'ai tant lu il y a cinq ans. L'occasion aussi de voir la dernière sculpture du même style découverte en 2019 à Trémuson (22). @museedebretagne #rennes #museedebretagne #archaeology #celticarchaeology #celticart #celtic #sculpture #torque #torc #bard #lyre #ancienthistory #inrap
Nice and interesting evening at the @palais.de.rumine for a conference about the newest discoveries on a Swiss archeological site (Vufflens-la-Ville) @palais.de.rumine #palaisderumine #mcah #archeology #archeodunum #archeologicalsite #archeologicalconference #studying #vufflenslaville #vaud #vaudtourisme #lausanne #celtics #celticarchaeology #swissarcheology #swiss #switzerland #switzerland🇨🇭
An interesting Bulletin of Prehistoric Studies of the Society of the Alpine Prehistoric Research of Aosta, with on the Cover a fantastic Celtic Coin. Courtesy of @archeo_svapa #art #arte #ancientart #antique #antiquities #istorija #arkeoloji #aosta #valledaosta #heritage #celtic #celticart #bulletin #prehistoriclife #prehistory #preistoria #bollettino #archeologie #archaeological #arqueologia #archaeologicalstudies #ancientcoins #artoftheday #artoninstagram #arthistorian #archeologia #celticartwork #celticarchaeology #archäologie #artefacts
Meistens zeichne und male ich, aber um meine Kenntnisse in Sachen Animation und Schnitt aufzufrischen, habe ich in letzter Zeit Spaß daran gefunden, kurze Videos zu erstellen. Hier also eine animierte Version der grafischen Rekonstruktionen des "Keltenfürsten vom Glauberg" - 2014 für das Museum @keltenweltglauberg - und einige der Funde aus dem Fürstengrab🤴🏻✨👑🏹🏺. Di solito disegno e dipingo, ma per rinfrescare le mie conoscenze di animazione ed editing, ultimamente mi sono divertita a creare brevi video. Quindi ecco in versione animata le ricostruzioni grafiche del „principe celtico di Glauberg“ - 2014 per il museo „Keltenwelt am Glauberg“ - ed alcuni dei reperti ritrovati nella tomba principesca. Mostly I draw and paint, but to brush up on my animation and editing skills, I've recently found fun in creating short videos. So here is an animated version of the graphic reconstructions of the "Celtic Prince of Glauberg" - 2014 for the museum @keltenweltamglauberg - and some of the finds from the prince's grave. music: MGMT - Little Dark Age (Medieval Style #bardcore) by Constantine Bard #keltenweltglauberg #kelten #keltenfürst #ancienthistory #eisenzeit #ironage #etàdelferro #vorgeschichte #archäologischeillustrationen #illustrazionearcheologica #archaeologicalillustration #archaeoart #archaeologymuseum #archäologie #archaeologicaldrawing #archaeologylovers #archaeologylove #ancientworlds #archaeoinstagram #archaeoinsta #archeologia #celticarchaeology #archaea_illustration_studio
Die Publikation „Glanzvoll ins Jenseits - die keltischen Prunkgräber vom Glauberg“ Autorin: Daniela Euler, Keltenwelt am Glauberg, 2020 ✨💎🌟 (Ich finde den Titel einfach brilliant 😄👌) . . #keltenweltglauberg #kelten #keltenfürst #ancienthistory #eisenzeit #ironage #etadelferro #etàdelferro #latene #latène #archäologie #archäologischeillustrationen #illustrazionearcheologica #archaeologicalillustration #archaeologymuseum #archäologie #archaeologicaldrawing #archaeologylovers #archaeologylove #ancientworlds #archaeoinstagram #archeologia #celticarchaeology #archaea_illustration_studio
Die zeichnerischen Rekonstruktionen des "Keltenfürsten vom Glauberg", die ich 2014 für das Museum "Keltenwelt am Glauberg" angefertigt habe🤴🏻🏺. Hier im Vergleich mit der 1996 im größten Grabhügel des Glaubergs gefundenen Statue, die wertvolle Hinweise auf die Kleidung, die Haar- und Barttracht und das Aussehen des "Prinzen" liefert - ein Mann zwischen 21 und 29 Jahren, etwa 169 cm groß und von robuster Figur. Bemerkenswert ist die sogenannte “Blattkrone“ - Kopfschmuck, die ein Mistelblatt darstellen könnte und somit den Krieger auch mit einem religiösen oder priesterlichen Kontext verbinden könnte. Le ricostruzioni grafiche del "Principe Celtico di Glauberg" che ho fatto nel 2014 per il museo "Keltenwelt am Glauberg". Qui a confronto con la statua trovata nel 1996 nel tumulo più grande del Glauberg, fonte di preziosi indizi sull'abbigliamento, l'acconciatura e l'aspetto del "principe" - un uomo tra i 21 e i 29 anni di età, alto circa 169 cm e di corporatura robusta. Notevole è il copricapo a „corona di foglie“, che potrebbe rappresentare una foglia di vischio e di conseguenza collegare il guerriero anche ad un contesto religioso o sacerdotale. The drawn reconstructions of the "Celtic Prince of the Glauberg" that I made in 2014 for the museum "Keltenwelt am Glauberg". Here in comparison with the statue found in 1996 in the largest burial mound of the Glauberg, which provides valuable clues to the clothing, hair and beard style and appearance of the "prince" - a man between 21 and 29 years of age, about 169 cm tall and of robust build. Remarkable is the so-called „leaf crown“ - headdress, which could represent a mistletoe leaf and thus also connect the warrior with a religious or priestly context. . . #keltenweltglauberg #keltenlandhessen #kelten #keltenfürst #ancienthistory #eisenzeit #ironage #etadelferro #etàdelferro #latene #latène #archäologie #archäologischeillustrationen #illustrazionearcheologica #archaeologicalillustration #archaeologymuseum #archaeologicaldrawing #archaeologylovers #wetterau #tourismusregionwetterau #ancientworlds #archaeoinstagram #archeologia #celticarchaeology #archaea_illustration_studio
The Roman Thermae of Bath #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath, the Tholos, the sacred source's overflow and the draining system #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath, the altar of Sulis Minerva #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath, the temple of Sulis Minerva #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
The Roman Thermae of Bath #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
I am very glad I kept the Roman baths for last, I wasn't expecting to LOVE it so much! One of the best archeological sites and museums I have visited so far! Everything was well explained, made me curious, and was the right amount of knowledge to learn and not overwhelm visitors. #romanhistory #romanempire #roman #romanbaths #thermae #thermaebathspa #bath #bathuk #bathbaths #archaeology #romanarchaeology #celtics #celts #celtic #celticarchaeology #romanarchitecture #celtroman #britain #britainhistory
Dimanche 6 mars à 11h VISITE GUIDÉE PAR MARC-ANTOINE KAESER, DIRECTEUR DU LATÉNIUM La traditionnelle visite du premier dimanche du mois vous emmène à la découverte d’un objet présenté dans l'espace "Les Celtes de la Tène". Depuis peu, un chantier mobile s'y est installé. Dès sa découverte en 1857, le site de La Tène a fait l’objet de recherches intenses. Suscitant des explications variées, des débats et des conflits d’interprétation, ces batailles savantes ont désormais cédé la place à la concertation scientifique. Des chercheuses et chercheurs de tous horizons ont contribué à renouveler notre compréhension de ce gisement. C’est ainsi que, plus de 20 ans après sa conception, le Laténium entame une refonte complète de cet espace. Marc-Antoine Kaeser présentera à cette occasion le site de Marin/Les Bourguignonnes. Visite gratuite, sans inscription préalable. #Laténium #archéologie #iloveswissmuseums #ironage #celticarchaeology #celticworld #LaTène #Neuchâtel
Another day, another standing stone though this is unmarked on the map (OS 160 @ SN9636). Impressive size and ground disturbance all around showing human activity or settlement or rites at some point. Great views over the Beacons and the military ranges 🙂 Intriguing.... #llanfihangelnantbran #standingstones #merthyrcynog #celticarchaeology #wales❤️
Above the village to the NE is Cefn Bola-maen with a trig and the solitary bronze age standing stone Maen Richard. Not as high as it once was, made of volcanic agglomerate, it stands at the meeting of three paths 🙏 #maenrichard #cefnbolamaen #standingstones #wales #bronzeage #powys #celticarchaeology
Celtic Culture, 200-100 BC, Saint Cybardeaux, France. A very rare Celtic Gold Stater of the Lemovices people found in the Gallic Sanctuary of the "Site des Bouchauds" Representing Stylized Figures of a Celtic Horseman. Courtrsy of @site_des_bouchauds #arteantica #antique #antiquities #istorija #arkeoloji #arqueologia #archeologie #archäologie #archaeologicalsite #celtic #archaeologicaldig #archaeology #gallic #saintcybardeaux #bouchauds #france #ancientart #celticart #celticwarrior #celticarchaeology #artsharer #arthistorian #arthistory #ancientcoins #celticcoin #numismatique #numismatic #numismatica #numismatics #goldstater
A design I done based on the Waterloo Helmet, a ceremonial horned helmet in the La Tène style found along the banks of the River Thames near Waterloo Bridge. #digitalart #digitalpainting #digitalillustration #animationprops #archaeology #celtichelmet #celticarchaeology #celticmythology #hornedhelmet #celticart
The extraordinary unique Gigantic Bronze Crater of Vix, dated 540-530 BC, Made in Greece but found in a Celtic Tomb of a Princess of the 6th Century, in Vix, France. This Tomb constitues in France, the Greatest Celtic Discovery of 20th Century. This majestic Crater, Highly and Finely Decorated with Gorgonians and Hoplite Friezes, Weighting more than 200 Kilos, and measures 1.64 meters High x 1,27 wide meters. Courtesy of @tresordevix #arteecultura #antique #antiquity #istorija #arkeoloji #arqueologia #archeologie #archäologie #archaeology #archeologia #fashionart #fashionvase #artsharer #artsharingpages #historylover #artlover #vix #chatillonsurseine #france #celticarchaeology #celtic #celticculture #burial #ancienttomb #greekvase #greekart #princess #celtictomb #artshare #ancienthistory
In the Celtic Myths, Miranda Aldhouse-Green attempts to situate the Welsh and Irish myths within the available history and archaeology. I loved how she finds archaeological artefacts to support elements of the myths. For example Oak trees were sacred to the Druids. The etymology of the word Druid or Druwydd may mean “wisdom of the Oak". In winter Oak trees are hosts to mistletoe – bright green balls with white berries symbolic of the moon (I was lucky enough to get some for this photo). In a famous account by chronicler Pliny the Elder in the 1st century he observed Gaulish Druids gathering mistletoe from Oak trees in winter, in a mysterious ceremony involving the sacrifice of two white bulls. In 1984 a body was found in a bog in Lindow Moss, Cheshire, England. His body dates to the 1st century. He suffered blows to the head and his throat had been cut while being garrotted. It may be that he was scarified, and suffered a “triple death". When examining the contents of the man’s stomach researchers found mistletoe. Perhaps the consumption of mistletoe was forced prior to sacrifice. Miranda Aldhouse-Green draws out other key elements featured in the myths for example the number 3 and shows how this was important to the Celtic people through symbolism used in artefacts like three sided stone faces and three forms to the one Goddess. She also explains how the myths came to be recorded from an initial oral tradition to be written down by monks in medieval times. This is part of a mythology series by Thames and Hudson, that is really well done. Each book is written by an academic and beautifully presented with illustrations and photos. If you are already familiar with the Celtic myths I’d highly recommend this book. I certainly found it useful in writing my book A Painted Winter, which features Druids and mistletoe and comes out tomorrow for the Winter Solstice! My beautiful Maeshowe and Newgrange candles are by @ashwoodcandles and are perfect for watching the livestream of the Winter Solstice (see my story). ❄ ❄ ❄ #celticart #celticmyths #celticarchaeology #celticmythology #irishmyths #welshmyths #wintersolstice #apaintedwinter #pictishconspiracyseries
❗️ASPETTA! Non scrollare❗️ 🪨 Anche se questa foto può sembrare insignificante, per me ha un grande valore. Infatti, mi ritrae nei panni di guida turistica presso il sito archeologico di Gallarus, in Irlanda. 🇮🇪 Oggi ho pubblicato una storia in cui vi mostro come i pullman turistici debbano percorrere strade strettissime e tortuose. In particolare, in quel video, mi trovavo lungo la Penisola di Dingle. 🌀 Dingle, oltre che per i splendidi paesaggi, è nota per siti archeologici di origine celtica estremamente importanti. Gallarus è infatti il primo esempio di chiesa protocristiana in Irlanda, e al suo fianco si trova questo particolarissimo cumulo di pietre con una stele in cui è incisa la prima croce celtica mai scolpita. Raccontare questo luogo per me è sempre stupendo e meraviglioso, perché la croce celtica rappresenta l’anima e lo spirito di questo popolo. Volete conoscere il significato e la sua origine? Seguitemi nel prossimo post e nella prossima storia! . . . #irlanda #ireland #gallarusoratory #celtic #celts #croceceltica #celticcross #northerneurope #travel #viaggiare #guidaturistica #ilovemyjob #archaeology #archeologia #celticarchaeology #archeologiaceltica #celticart #tourguide #irishpassionbnw @guidescanner
2400 year old blue textile with red grid-checks. Saltmine, what else.. #archaeologicaltextileoftheday In this case from Dürrnberg near Hallein @keltenmuseum.hallein This weekend, a "celtic symposium" will be held in Hallein to celebrate 50 years of research. Swipe to the next page and you will find a reconstruction of this textile, hand-woven by the wonderful @textilmanufaktur_galz The Iron Age textiles from Dürrnberg as well as those from Hallstatt belong to our european textile heritage. @euro_web #archaeologicalreconstruction #archaeologicaltextile #textilearchaeology #celtictextile #celticarchaeology #ironagedesigns #ironagetextiles #ancientdress #ancientfashion #antiquetextiles #archaeologicaltextileoftheday
🐗A hét műtárgya - A BÁTAI VADKAN Késő vaskor, La Tène-kultúra (Kr.e. 2. sz.?) Báta, szórvány Öntött bronz H.: 10,9 cm MNM Budapest, 88.1893.25. Forrás: 📸 kép: Magyar Nemzeti Múzeum @magyarnemzetimuzeum 📖adatok: Vágó Ádám: a Kárpát-medence ősi kincsei - A kőkortól a honfoglalásig ⚔️A Kr. e. 4. században a mai Magyarország egész területét a kelták hódították meg. Fejlett vasművességükről, ötvösművészetükről a Bátán előkerült bronz vadkanszobrocska is tanúskodik. A kelta sírokba a korai időktől kezdve némelykor háziasított sertések darabjait, sőt néha teljes állatot tettek. Valószínű, hogy a bátai „vadkan” ennek a fajtának az ábrázolása. 🏺A szobor mintegy 11 centiméter hosszú és közel 8 centiméter magas. Az állat megformálása realisztikus, valósághű, de a háton végigfutó sörte szálait növényi indára emlékeztető spirális és S-motívumok érzékeltetik. A vadkan fejének alján található lyuk alapján valószínűleg rátétdísz lehetett, amelyet sisakra vagy hadijelvényre szereltek fel. 🐗A vadkan a kelta vallás fontos szereplője, az istenek kísérőállata volt. Szinte minden La Tène-sírban kerülnek elő sertéscsontok az elhunytnak szánt étel maradványaként. 📚 Olvasnivaló: 👉Szabó Miklós: A keleti kelták - A késő vaskor a Kárpát - medencében. L'Harmattan Kiadó, 2005. #archaeology #ironage #régészet #ahétműtárgya #hungarianarchaeology #artefactoftheweek #artefact #celticarchaeology #celts #celtic #prehistoric #ritual